General Information

  • ID:  hor000697
  • Uniprot ID:  Q16568
  • Protein name:  CART(42-89)
  • Gene name:  CARTPT
  • Organism:  Homo sapiens (Human)
  • Family:  CART family
  • Source:  Human
  • Expression:  By leptin.|Hypothalamus. Found in neurons of the ventrolateral part of the arcuate nucleus, in the external zone of the median eminence, and also found in terminals in the periventricular part of the paraventricular nucleus.
  • Disease:  Diseases associated with CARTPT include Body Mass Index Quantitative Trait Locus 11 and Leptin Deficiency Or Dysfunction.
  • Comments:  NA
  • Taxonomy:  Homo (genus), Homininae (subfamily), Hominidae (family), Hominoidea (superfamily), Catarrhini (parvorder), Simiiformes (infraorder), Haplorrhini (suborder), Primates (order), Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0003674 molecular_function; GO:0005184 neuropeptide hormone activity; GO:0005515 protein binding
  • GO BP:  GO:0001678 intracellular glucose homeostasis; GO:0007165 signal transduction; GO:0007186 G protein-coupled receptor signaling pathway; GO:0007218 neuropeptide signaling pathway; GO:0007267 cell-cell signaling; GO:0007268 chemical synaptic transmission; GO:0008343 adult feeding behavior; GO:0009267 cellular response to starvation; GO:0032099 negative regulation of appetite; GO:0032812 positive regulation of epinephrine secretion; GO:0032922 circadian regulation of gene expression; GO:0043410 positive regulation of MAPK cascade; GO:0045671 negative regulation of osteoclast differentiation; GO:0045777 positive regulation of blood pressure; GO:0045779 negative regulation of bone resorption; GO:0045860 positive regulation of protein kinase activity; GO:0046850 regulation of bone remodeling; GO:0050796 regulation of insulin secretion; GO:0051971 positive regulation of transmission of nerve impulse; GO:0070093 negative regulation of glucagon secretion; GO:0070253 somatostatin secretion
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0030141 secretory granule; GO:0045202 synapse

Sequence Information

  • Sequence:  VPIYEKKYGQVPMCDAGEQCAVRKGARIGKLCDCPRGTSCNSFLLKCL
  • Length:  48(69-116)
  • Propeptide:  MESSRVRLLPLLGAALLLMLPLLGTRAQEDAELQPRALDIYSAVDDASHEKELIEALQEVLKKLKSKRVPIYEKKYGQVPMCDAGEQCAVRKGARIGKLCDCPRGTSCNSFLLKCL
  • Signal peptide:  MESSRVRLLPLLGAALLLMLPLLGTRA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Satiety factor closely associated with the actions of leptin and neuropeptide y; this anorectic peptide inhibits both normal and starvation-induced feeding and completely blocks the feeding response induced by neuropeptide Y and regulated by leptin in the
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  14-32; 20-40; 34-47
  • Structure ID:  1hy9(PDB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    1hy9.pdbhor000697_AF2.pdbhor000697_ESM.pdb

Physical Information

Mass: 608978 Formula: C225H371N65O65S7
Absent amino acids: HW Common amino acids: C
pI: 8.62 Basic residues: 8
Polar residues: 17 Hydrophobic residues: 13
Hydrophobicity: -15.21 Boman Index: -6616
Half-Life: 100 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 73.13
Instability Index: 2090.83 Extinction Coefficient cystines: 3355
Absorbance 280nm: 71.38

Literature

  • PubMed ID:  NA
  • Title:  NA